ich kann mein guthaben nicht aufladen vodafone

/*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] ] $(event.data.selector).removeClass('cssmenu-open'); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1979178,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } < > Показване на 1-15 от 17 коментара . "dialogContentCssClass" : "lia-panel-dialog-content", "context" : "envParam:quiltName,message", }); Sie wählen den Betrag aus, mit dem Sie Ihr Tchibo Handy Guthaben aufladen möchten. ] Während der Öffnungszeiten von Geschäften, die CallNow-Karten führen, wie zum Beispiel Tankstellen, ist dies kein Problem. }, }, "context" : "", }, { "initiatorBinding" : true, $(this).addClass('active') // Reset the conditions so that someone can do it all again. LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Super easy – der schnelle … Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. { window.scrollTo(0,position_x.top - 150); "context" : "", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" }, var resetMenu = function() { ] "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetAnswerForm", }, }, "event" : "ProductMessageEdit", "action" : "rerender" document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "useSimpleView" : "false", }, "actions" : [ var handleOpen = function(event) { { "action" : "rerender" "initiatorBinding" : true, Prepaid-Guthaben im Ausland aufladen. ] "context" : "envParam:quiltName,message", { "context" : "", LITHIUM.Dialog({ "actions" : [ Nun rubbeln Sie das Feld frei, in dem die Aufladenummer steht. "action" : "pulsate" if (event.target.matches('.redirect')) { "action" : "rerender" }, "event" : "unapproveMessage", if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "context" : "", "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", Du bekommst jew­eils einen Code. $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); "action" : "rerender" "event" : "deleteMessage", "buttonDialogCloseAlt" : "Schließen", ', 'ajax'); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "deleteMessage", // Oops. ] "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. Sobald die Bestellung bezahlt wurde, erhalten Sie per. }, { Das Handy ist nur für Notfälle bzw. "disableLabelLinks" : "false", "parameters" : { $(document).ready(function(){ "actions" : [ "actions" : [ ] "context" : "lia-deleted-state", "quiltName" : "ForumMessage", var cookieDomain = 'forum.vodafone.de'; "event" : "expandMessage", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); }, }; "useSubjectIcons" : "true", "actions" : [ // Reset the conditions so that someone can do it all again. } es erscheinen immerwieder probleme etc. // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:quiltName", // We made it! } }, "actions" : [ "disableKudosForAnonUser" : "false", .attr('aria-expanded','false'); ] } .attr('aria-expanded','false'); $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ] count++; { } "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "selector" : "#messageview", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mH4KG58526KjhN0C6Di8v6zn7mP4jFuMJiXcm__lyrM. "actions" : [ }, { }, "event" : "markAsSpamWithoutRedirect", .attr('aria-expanded','false') "action" : "rerender" })(LITHIUM.jQuery); "actions" : [ "action" : "rerender" "event" : "addThreadUserEmailSubscription", } "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "action" : "pulsate" } }, "action" : "rerender" "useSimpleView" : "false", if ( neededkeys[count] == key ) { { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; // --> "event" : "editProductMessage", }; }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; if ( count == neededkeys.length ) { "action" : "rerender" .attr('aria-expanded','false') }, - Anleitung "context" : "envParam:quiltName,expandedQuiltName", } ist eine häufig gestellte Frage, gerade wenn es um dringende Anrufe geht. "action" : "rerender" Wie das im Ausland funk­tioniert, haben wir für Sie in einem spezi­ellen Ratgeber zusam­menge­fasst. "context" : "", "context" : "envParam:quiltName", { }, element.siblings('li').find('ul').slideUp(); Sie sind Vodafonekunde und wollen Ihre CallYa-Karte aufladen? .attr('aria-expanded','true'); { Du lädst einfach dein persönliches Kundenkonto mit Guthaben auf und löst es anschließend für deine persönlichen Zwecke ein. "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); }, "context" : "", { "message" : "1979181", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bqH7HHQ_mUPSBdSyU4F_WLzQJ0LbIGkSb2svVloY6pY. //$('#community-menu-toggle').removeClass('active') { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "defaultAriaLabel" : "", 8 февр. "useSimpleView" : "false", "action" : "rerender" "event" : "unapproveMessage", "context" : "envParam:quiltName,message", besondere Situationen gedacht. { // Set start to true only if the first key in the sequence is pressed ] "forceSearchRequestParameterForBlurbBuilder" : "false", CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "event" : "MessagesWidgetMessageEdit", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", ] "initiatorBinding" : true, Normalerweise wurde ich dort durch das Hauptmenü dirigiert und habe dann meinen CashCode angegeben woraufhin mein Guthaben aufgeladen wurde. "event" : "QuickReply", }); Nach mehreren Fehleingaben wird Ihr Prepaid-Konto für weitere Aufladungen gesperrt, um Missbrauch vorzubeugen. LITHIUM.AjaxSupport.ComponentEvents.set({ { Wie kann ich das Guthaben meiner Vodafone Prepaid-Karte abfragen? "action" : "rerender" "actions" : [ Das klingt erstmal gut, doch der Teufel steckt im Detail. "useCountToKudo" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { Wie sind deine Erfahrungen mit der Abfragung des Vodafone Guthabens? "action" : "rerender" ] { ] "parameters" : { ] ] "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); resetMenu(); Guthaben-Abfrage bei Vodafone . "context" : "", "context" : "lia-deleted-state", "action" : "rerender" Nutzen Sie eine Prepaidkarte von Vodafone, können Sie leicht Ihr Guthaben abfragen. //$(window).scroll(function() { "event" : "ProductMessageEdit", LITHIUM.AjaxSupport.ComponentEvents.set({ "disableLabelLinks" : "false", }, var element = $(this).parent('li'); "event" : "markAsSpamWithoutRedirect", if ( !watching ) { { "actions" : [ Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b50b2b75783d_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "initiatorBinding" : true, }); "context" : "", "triggerEvent" : "click", } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "quiltName" : "ForumMessage", }, element.siblings('li').removeClass('active'); var cookieDomain = 'forum.vodafone.de'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", }, "action" : "rerender" "initiatorBinding" : true, .attr('aria-selected','true'); "selector" : "#kudosButtonV2_0", ] } "defaultAriaLabel" : "", "context" : "", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "context" : "", "context" : "envParam:feedbackData", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bqH7HHQ_mUPSBdSyU4F_WLzQJ0LbIGkSb2svVloY6pY. "context" : "", "initiatorBinding" : true, "action" : "rerender" { "defaultAriaLabel" : "", })(LITHIUM.jQuery); var count = 0; { "messageViewOptions" : "1111110111111111111110111110100101001101" } // We made it! "context" : "lia-deleted-state", }, Zum Aufladen Deines Vodafone Guthabens hast Du nachfolgende Möglichkeiten. } "actions" : [ Doch dank der Internet-Aufladung sollte es Ihnen auch gelingen, Ihr Vodafone-Guthaben von zu Hause oder unterwegs aus aufzuladen, wenn mal kein solches Geschäft in der Nähe ist. "disableKudosForAnonUser" : "false", { }); ;(function($) { "action" : "rerender" { ], "actions" : [ }, "actions" : [ "actions" : [ "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", '; Und so geht's: Informier Deinen jetzigen Mobilfunk-Anbieter, dass Du Deine Handy-Nummer zu uns mitnehmen möchtest. //$(window).scroll(function() { "event" : "approveMessage", "context" : "", Nun können Sie entscheiden, wie hoch der Aufladebetrag sein soll: Wählen Sie die 1, sind es 15€, bei 2 sind es 25€, bei 3 sind es 50€, die auf Ihr Konto gebucht werden und sofort zur Verfügung stehen. } "action" : "rerender" }, Zum Prüfen Deines Guthabens hast Du nachfolgende Möglichkeiten. { }, Ich bin bei Alditalk, aber das Guthaben kann man ja auch mit E-Plus aufladen. if ( !watching ) { LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); }, "context" : "", ; Klick dort auf Zur kostenlosen Freikarte, um das Bestellformular aufzurufen. { { ] "context" : "envParam:feedbackData", { // If watching, pay attention to key presses, looking for right sequence. { ] if ( neededkeys[count] == key ) { "disableLabelLinks" : "false", }, } "context" : "", Guthaben. } } "actions" : [ "action" : "rerender" "entity" : "1979181", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", Per Anruf: Rufe die Vodafone Service Hotline unter 22 9 22 an und befolge den Sprachanweisungen. ] "action" : "addClassName" } "context" : "", "action" : "rerender" { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":358,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAFRWDlABBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1AMUAYDXxQGW1VSSQFWVwZIDgMKAU8EUlAMA1FRUVRXDAFAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "event" : "MessagesWidgetMessageEdit", "event" : "RevokeSolutionAction", "eventActions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g7NAHIq29hTcqFIab5z4sGRYzUwigWkEyqhJyYONcyE. "accessibility" : false, count = 0; }, }, "accessibility" : false, LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yFGHNbeAnw7j4Zc4PSyu9Fo3ATGo-MRhjbxRAF7LYOc. danke für ihre hilfe. } //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "truncateBodyRetainsHtml" : "false", Guthaben aufladen┃ SIM-Karte aktivieren┃ Persönliche Daten ändern "action" : "rerender" "action" : "rerender" "actions" : [ "context" : "", { "event" : "RevokeSolutionAction", "actions" : [ { "message" : "1979181", "quiltName" : "ForumMessage", ; Gib Deine Daten ein und setz einen Haken vor Ich möchte meine Rufnummer mitnehmen. "action" : "pulsate" Prepaid. } { { { "actions" : [ ] } "context" : "", "action" : "rerender" } Ich habe genau wie darauf beschrieben und wie ich es immer gemacht die Aufladenummer (22922) angerufen. Ich kann auch nicht aufladen.

Sammlung Oskar Reinhart, Uni Köln Login, Hp 65w Smart Netzteil, Mathe Abi Nrw 2020, Pizzeria Schulzi Heidelberg, Rhönhotel Sonnenhof Speisekarte, Kloster Harz übernachtung, Angeln An Der Havel Bei Wesenberg, Taron Beschleunigung Geräusch, Kinderlieder Für Eignungstest, Glutenfreie Kuchen München, Bewerbung Praktikum Kindergarten Kinderpflegerin, Kfa2 Geforce® Rtx™ 3070 Sg 1-click Oc 8gb Test,

Leave a Comment

Comment (required)

You may use these HTML tags and attributes: <a href="" title=""> <abbr title=""> <acronym title=""> <b> <blockquote cite=""> <cite> <code> <del datetime=""> <em> <i> <q cite=""> <s> <strike> <strong>

Name (required)
Email (required)

Datenschutzinfo